PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0016s0177.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family ARR-B
Protein Properties Length: 777aa    MW: 82835.8 Da    PI: 5.9788
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0016s0177.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.81.2e-28265318155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kpr++W+ eLH++Fv+av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  Sphfalx0016s0177.1.p 265 KPRVVWSVELHQQFVSAVNQL-GIDKAVPKRILELMSVQGLTRENVASHLQKYRL 318
                           79*******************.********************************8 PP

2Response_reg81.33.2e-27821901109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           +l+vdD+p+ + +l+++l++  y +v+++  ++ alell+e +  +Dl++ D+ mp+mdG++ll+     e++lp+i+++++ge + + 
  Sphfalx0016s0177.1.p  82 ILVVDDDPTCLAILKKMLQQCSY-QVTTCGRATRALELLREDKdkFDLVISDVYMPDMDGFKLLELVGL-EMDLPVIMMSGNGETSVVM 168
                           89*********************.***************888778*******************87754.558**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l Kp+ +eel +
  Sphfalx0016s0177.1.p 169 KGITHGACDYLLKPVRIEELSN 190
                           *******************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23006.2E-4379214No hitNo description
SuperFamilySSF521721.2E-3679204IPR011006CheY-like superfamily
SMARTSM004482.9E-3280192IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.00381196IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.6E-2482190IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.69E-2883199No hitNo description
PROSITE profilePS5129411.072262321IPR017930Myb domain
SuperFamilySSF466891.76E-19262322IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-29264323IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-25265318IPR006447Myb domain, plants
PfamPF002498.2E-7267317IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
MSGGDLSRVR EGTADLDPVM ASHQHPPPRQ QSHQQPKNHQ QEAHQQHCSS AETTSPNNTA  60
RGAGATYGKM EPADDFPAGL RILVVDDDPT CLAILKKMLQ QCSYQVTTCG RATRALELLR  120
EDKDKFDLVI SDVYMPDMDG FKLLELVGLE MDLPVIMMSG NGETSVVMKG ITHGACDYLL  180
KPVRIEELSN IWQHVVRKLR SEPKEHSASL EDGDRQRRGG AEDADNTSSA ADTADGIWRN  240
KKKKEAKEDE EDFEQDNDDP STLKKPRVVW SVELHQQFVS AVNQLGIDKA VPKRILELMS  300
VQGLTRENVA SHLQKYRLYL KRLSGVTSQS NSLNVSFGGP DAGYGGLFGL DEMSDYRNLV  360
TNGHLPAQTI AALHHANMAG RLGASSGMVG PSSPLDPSVL AQIAALQSGS LPRPGMDGSL  420
QGNQAGLLQS LSGALDYNSL HQSHLLPAIG QLGQLDELPS LKSMQHQLGM GSLGGSTRNL  480
AGSPNEELTM QLLQQRAQQQ SGGSPINLPQ ATGILRPLSS NINQGGSVPN LVGVIPGTAI  540
GLSNMCSGGR EFGSSSGLLS ASGSLMQSST VEAQNLNFGG SSGSSGCSFQ ASVLSSKTGG  600
LEDLNPAKRV RTTYSALSHS SPDLGQSSRP AWLGSQEGLV HGDPVYSPHQ LSLPRQDIVG  660
GIGSSGRPAY MGSQSMGSLG MNFPLSLAVD AGAVRPSLTR GQSLTEQVAA NRELKFPKEE  720
RGRDNLMCAR LGGGMITNES SSEELLNYLK QSHEGLGFME GDLVSDGYPV DNLYVK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-22264324464ARR10-B
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1238244RNKKKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S16_393V6.11e-152(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.11e-107response regulator 1